TOP2A monoclonal antibody (M01), clone 1E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant TOP2A.
Immunogen
TOP2A (NP_001058, 1435 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (68); Rat (71)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TOP2A monoclonal antibody (M01), clone 1E2 Western Blot analysis of TOP2A expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOP2A on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TOP2A is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TOP2A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TOP2A
Entrez GeneID
7153GeneBank Accession#
NM_001067Protein Accession#
NP_001058Gene Name
TOP2A
Gene Alias
TOP2, TP2A
Gene Description
topoisomerase (DNA) II alpha 170kDa
Omim ID
126430Gene Ontology
HyperlinkGene Summary
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromsome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. [provided by RefSeq
Other Designations
DNA topoisomerase II, 170 kD|DNA topoisomerase II, alpha isozyme|topoisomerase (DNA) II alpha (170kD)
-
Interactomes
-
Diseases
-
Publication Reference
-
Chromosome Scaffold is a Double-Stranded Assembly of Scaffold Proteins.
Poonperm R, Takata H, Hamano T, Matsuda A, Uchiyama S, Hiraoka Y, Fukui K.
Scientific Reports 2015 Jul; 5:11916.
Application:IF, Human, HeLa cells.
-
Chromosome Scaffold is a Double-Stranded Assembly of Scaffold Proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com