HMGB1 monoclonal antibody (M03), clone 1B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HMGB1.
Immunogen
HMGB1 (AAH03378.1, 1 a.a. ~ 215 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (49.39 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M03), clone 1B11.
Lane 1: HMGB1 transfected lysate(25 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HMGB1 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — HMGB1
Entrez GeneID
3146GeneBank Accession#
BC003378Protein Accession#
AAH03378.1Gene Name
HMGB1
Gene Alias
DKFZp686A04236, HMG1, HMG3, SBP-1
Gene Description
high-mobility group box 1
Omim ID
163905Gene Ontology
HyperlinkOther Designations
Amphoterin|OTTHUMP00000018199|OTTHUMP00000190860|Sulfoglucuronyl carbohydrate binding protein|high mobility group box 1|high mobility group protein 1|high-mobility group (nonhistone chromosomal) protein 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Anti-inflammatory effects of hyperoside in human endothelial cells and in mice.
Ku SK, Zhou W, Lee W, Han MS, Na M, Bae JS.
Inflammation 2015 Apr; 38(2):784.
Application:ELISA, IF, Human, HUVEC.
-
Failure of anti tumor-derived endothelial cell immunotherapy depends on augmentation of tumor hypoxia.
Annalisa Pezzolo, Danilo Marimpietri, Lizzia Raffaghello, Claudia Cocco, Angela Pistorio, Claudio Gambini, Michele Cilli, Alberto Horenstein, Fabio Malavasi, Vito Pistoia.
Oncotarget 2014 Nov; 5(21):10368.
Application:IF, IHC-P, Human, Mouse, HTLA-230 cells, Orthotopic mouse model of human neuroblastoma.
-
Proteomic analysis of human Epithelial Lining Fluid by microfluidics-based nanoLC-MS/MS: a feasibility study.
Franciosi L, Govorukhina N, Fusetti F, Poolman B, Lodewijk ME, Timens W, Postma D, ten Hacken N, Bischoff R.
Electrophoresis 2013 Sep; 34(18):2683.
Application:IHC, Human, Lung.
-
Anti-inflammatory effects of hyperoside in human endothelial cells and in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com