MMP1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MMP1 MaxPab polyclonal antibody. Western Blot analysis of MMP1 expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of MMP1 expression in transfected 293T cell line (H00004312-T01) by MMP1 MaxPab polyclonal antibody.
Lane 1: MMP1 transfected lysate(51.59 KDa).
Lane 2: Non-transfected lysate.
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human MMP1 protein.
Immunogen
MMP1 (NP_002412.1, 1 a.a. ~ 469 a.a) full-length human protein.
Sequence
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (59); Rat (58)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MMP1 MaxPab polyclonal antibody. Western Blot analysis of MMP1 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of MMP1 expression in transfected 293T cell line (H00004312-T01) by MMP1 MaxPab polyclonal antibody.
Lane 1: MMP1 transfected lysate(51.59 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MMP1
Entrez GeneID
4312GeneBank Accession#
NM_002421Protein Accession#
NP_002412.1Gene Name
MMP1
Gene Alias
CLG, CLGN
Gene Description
matrix metallopeptidase 1 (interstitial collagenase)
Gene Ontology
HyperlinkGene Summary
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. Alternative splicing results in multiple transcript variants.[provided by RefSeq
Other Designations
fibroblast collagenase|interstitial collagenase|matrix metalloprotease 1|matrix metalloproteinase 1|matrix metalloproteinase 1 (interstitial collagenase)
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Identification of candidate circulating cisplatin-resistant biomarkers from epithelial ovarian carcinoma cell secretomes.
Teng PN, Wang G, Hood BL, Conrads KA, Hamilton CA, Maxwell GL, Darcy KM, Conrads TP.
British Journal of Cancer 2014 Jan; 110(1):123.
Application：WB-Ce, Human, A2780, A2780-CP20, OVCAR3, CaOV3, OV90 cells.
-
Identification of candidate circulating cisplatin-resistant biomarkers from epithelial ovarian carcinoma cell secretomes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com