IGLL1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IGLL1 protein.
Immunogen
IGLL1 (NP_064455.1, 1 a.a. ~ 213 a.a) full-length human protein.
Sequence
MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (59); Rat (61)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
IGLL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of IGLL1 expression in human spleen.Western Blot (Tissue lysate)
IGLL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of IGLL1 expression in mouse spleen.Western Blot (Transfected lysate)
Western Blot analysis of IGLL1 expression in transfected 293T cell line (H00003543-T03) by IGLL1 MaxPab polyclonal antibody.
Lane 1: IGLL1 transfected lysate(23.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IGLL1
Entrez GeneID
3543GeneBank Accession#
NM_020070Protein Accession#
NP_064455.1Gene Name
IGLL1
Gene Alias
14.1, CD179b, IGL1, IGL5, IGLJ14.1, IGLL, IGO, IGVPB, VPREB2
Gene Description
immunoglobulin lambda-like polypeptide 1
Gene Ontology
HyperlinkGene Summary
The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. This gene encodes one of the surrogate light chain subunits and is a member of the immunoglobulin gene superfamily. This gene does not undergo rearrangement. Mutations in this gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CD179b antigen|Pre-B lymphocyte-specific protein-2|immunoglobulin omega polypeptide chain|immunoglobulin-related 14.1 protein|lambda5
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com