IGLL1 purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00003543-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

IGLL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of IGLL1 expression in human spleen.

Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

IGLL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of IGLL1 expression in mouse spleen.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of IGLL1 expression in transfected 293T cell line (H00003543-T03) by IGLL1 MaxPab polyclonal antibody.

Lane 1: IGLL1 transfected lysate(23.00 KDa).
Lane 2: Non-transfected lysate.

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against a full-length human IGLL1 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    IGLL1 (NP_064455.1, 1 a.a. ~ 213 a.a) full-length human protein.

    Sequence

    MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS

    Host

    Rabbit

    Reactivity

    Human, Mouse

    Interspecies Antigen Sequence

    Mouse (59); Rat (61)

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Tissue lysate)

    IGLL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of IGLL1 expression in human spleen.

    Western Blot (Tissue lysate)

    IGLL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of IGLL1 expression in mouse spleen.

    Western Blot (Transfected lysate)

    Western Blot analysis of IGLL1 expression in transfected 293T cell line (H00003543-T03) by IGLL1 MaxPab polyclonal antibody.

    Lane 1: IGLL1 transfected lysate(23.00 KDa).
    Lane 2: Non-transfected lysate.
  • Gene Info — IGLL1

    Entrez GeneID

    3543

    GeneBank Accession#

    NM_020070

    Protein Accession#

    NP_064455.1

    Gene Name

    IGLL1

    Gene Alias

    14.1, CD179b, IGL1, IGL5, IGLJ14.1, IGLL, IGO, IGVPB, VPREB2

    Gene Description

    immunoglobulin lambda-like polypeptide 1

    Omim ID

    146770 601495

    Gene Ontology

    Hyperlink

    Gene Summary

    The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. This gene encodes one of the surrogate light chain subunits and is a member of the immunoglobulin gene superfamily. This gene does not undergo rearrangement. Mutations in this gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

    Other Designations

    CD179b antigen|Pre-B lymphocyte-specific protein-2|immunoglobulin omega polypeptide chain|immunoglobulin-related 14.1 protein|lambda5

  • Interactome
  • Pathway
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All