ENO2 monoclonal antibody (M01), clone 1A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ENO2 monoclonal antibody (M01), clone 1A3. Western Blot analysis of ENO2 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
ENO2 monoclonal antibody (M01), clone 1A3. Western Blot analysis of ENO2 expression in different cell lines.
Western Blot (Transfected lysate)
Western Blot analysis of ENO2 expression in transfected 293T cell line by ENO2 monoclonal antibody (M01), clone 1A3.
Lane 1: ENO2 transfected lysate(47.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ENO2 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant ENO2.
Immunogen
ENO2 (AAH02745, 325 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ENO2 monoclonal antibody (M01), clone 1A3. Western Blot analysis of ENO2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
ENO2 monoclonal antibody (M01), clone 1A3. Western Blot analysis of ENO2 expression in different cell lines.Western Blot (Transfected lysate)
Western Blot analysis of ENO2 expression in transfected 293T cell line by ENO2 monoclonal antibody (M01), clone 1A3.
Lane 1: ENO2 transfected lysate(47.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ENO2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ENO2
Entrez GeneID
2026GeneBank Accession#
BC002745Protein Accession#
AAH02745Gene Name
ENO2
Gene Alias
NSE
Gene Description
enolase 2 (gamma, neuronal)
Omim ID
131360Gene Ontology
HyperlinkGene Summary
This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq
Other Designations
2-phospho-D-glycerate hydrolyase|enolase 2|neural enolase|neuron specific gamma enolase|neurone-specific enolase
-
Interactomes
-
Pathways
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
- Metabolic pathways
+ View More Disease
-
Diseases
-
Publication Reference
-
The influence of gaseous microemboli on various biomarkers after minimized cardiopulmonary bypass.
Stehouwer MC, de Vroege R, Bruggemans EF, Hofman FN, Molenaar MA, van Oeveren W, de Mol BA, Bruins P.
Perfusion 2019 Aug; 267659119867572.
Application：Cap Ab, ELISA, Human, Human blood.
-
Identification of alpha-Enolase as an Autoantigen in Lung Cancer: Its Overexpression Is Associated with Clinical Outcomes.
Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY.
Clinical Cancer Research 2006 Oct; 12(19):5746.
Application：WB-Tr, Human, HeLa cells.
-
The influence of gaseous microemboli on various biomarkers after minimized cardiopulmonary bypass.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com