EMX2 monoclonal antibody (M06), clone 4F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EMX2.
Immunogen
EMX2 (NP_004089, 103 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EMX2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — EMX2
Entrez GeneID
2018GeneBank Accession#
NM_004098Protein Accession#
NP_004089Gene Name
EMX2
Gene Alias
-
Gene Description
empty spiracles homeobox 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a homeobox-containing transcription factor that is the homolog to the 'empty spiracles' gene in Drosophila. Research on this gene in humans has focused on its expression in three tissues: dorsal telencephalon, olfactory neuroepithelium, and urogenetial system. It is expressed in the dorsal telencephalon during development in a low rostral-lateral to high caudal-medial gradient and is proposed to pattern the neocortex into defined functional areas. It is also expressed in embryonic and adult olfactory neuroepithelia where it complexes with eukaryotic translation initiation factor 4E (eIF4E) and possibly regulates mRNA transport or translation. In the developing urogenital system, it is expressed in epithelial tissues and is negatively regulated by HOXA10. Alternative splicing results in multiple transcript variants encoding distinct proteins
Other Designations
OTTHUMP00000020578|empty spiracles homolog 2
-
Interactome
-
Disease
-
Publication Reference
-
Emx2 expression levels in NSCs modulate astrogenesis rates by regulating EgfR and Fgf9.
Falcone C, Filippis C, Granzotto M, Mallamaci A.
Glia 2015 Mar; 63(3):412.
Application:IF, Mouse, Brain.
-
Emx2 expression levels in NSCs modulate astrogenesis rates by regulating EgfR and Fgf9.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com