
EMX2 purified MaxPab rabbit polyclonal antibody (D01P)

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Rabbit polyclonal antibody raised against a full-length human EMX2 protein.
Immunogen
EMX2 (NP_004089.1, 1 a.a. ~ 252 a.a) full-length human protein.
Sequence
MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EMX2 MaxPab rabbit polyclonal antibody. Western Blot analysis of EMX2 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of EMX2 expression in transfected 293T cell line (H00002018-T01) by EMX2 MaxPab polyclonal antibody.
Lane 1: EMX2 transfected lysate(27.72 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — EMX2
Entrez GeneID
2018GeneBank Accession#
NM_004098.3Protein Accession#
NP_004089.1Gene Name
EMX2
Gene Alias
-
Gene Description
empty spiracles homeobox 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a homeobox-containing transcription factor that is the homolog to the 'empty spiracles' gene in Drosophila. Research on this gene in humans has focused on its expression in three tissues: dorsal telencephalon, olfactory neuroepithelium, and urogenetial system. It is expressed in the dorsal telencephalon during development in a low rostral-lateral to high caudal-medial gradient and is proposed to pattern the neocortex into defined functional areas. It is also expressed in embryonic and adult olfactory neuroepithelia where it complexes with eukaryotic translation initiation factor 4E (eIF4E) and possibly regulates mRNA transport or translation. In the developing urogenital system, it is expressed in epithelial tissues and is negatively regulated by HOXA10. Alternative splicing results in multiple transcript variants encoding distinct proteins
Other Designations
OTTHUMP00000020578|empty spiracles homolog 2
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com