FIS1 monoclonal antibody (M01), clone 1G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FIS1 monoclonal antibody (M01), clone 1G9. Western Blot analysis of FIS1 expression in human liver.
Western Blot (Cell lysate)
FIS1 monoclonal antibody (M01), clone 1G9 Western Blot analysis of FIS1 expression in A-431 ( Cat # L015V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FIS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FIS1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (42.46 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant FIS1.
Immunogen
FIS1 (AAH03540.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.46 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FIS1 monoclonal antibody (M01), clone 1G9. Western Blot analysis of FIS1 expression in human liver.Western Blot (Cell lysate)
FIS1 monoclonal antibody (M01), clone 1G9 Western Blot analysis of FIS1 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FIS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FIS1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — FIS1
Entrez GeneID
51024GeneBank Accession#
BC003540Protein Accession#
AAH03540.1Gene Name
FIS1
Gene Alias
CGI-135, TTC11
Gene Description
fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Omim ID
609003Gene Ontology
HyperlinkGene Summary
The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM
Other Designations
H_NH0132A01.6|tetratricopeptide repeat domain 11
-
Interactomes
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com