PAK1 monoclonal antibody (M02), clone 4D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PAK1.
Immunogen
PAK1 (NP_002567, 191 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PAK1 expression in transfected 293T cell line by PAK1 monoclonal antibody (M02), clone 4D1.
Lane 1: PAK1 transfected lysate (Predicted MW: 49.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PAK1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of PAK1 transfected lysate using anti-PAK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PAK1 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAK1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PAK1 on HeLa cell. [antibody concentration 35 ug/ml] -
Gene Info — PAK1
Entrez GeneID
5058GeneBank Accession#
NM_002576Protein Accession#
NP_002567Gene Name
PAK1
Gene Alias
MGC130000, MGC130001, PAKalpha
Gene Description
p21 protein (Cdc42/Rac)-activated kinase 1
Omim ID
602590Gene Ontology
HyperlinkGene Summary
PAK proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling. PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. These proteins serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK1 regulates cell motility and morphology. Alternativelt spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
STE20 homolog, yeast|p21-activated kinase 1|p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)|p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Fragile X Related Protein 1 Clusters with Ribosomes and Messenger RNAs at a Subset of Dendritic Spines in the Mouse Hippocampus.
Cook D, Del Rayo Sanchez-Carbente M, Lachance C, Radzioch D, Tremblay S, Khandjian EW, Desgroseillers L, Murai KK.
PLoS One 2011 Oct; 6(10):e26120.
Application:IF, Mouse, Hippocampus, Neurons.
-
Fragile X Related Protein 1 Clusters with Ribosomes and Messenger RNAs at a Subset of Dendritic Spines in the Mouse Hippocampus.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com