HMGB1 monoclonal antibody (M02), clone 1D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HMGB1.
Immunogen
HMGB1 (AAH03378.1, 1 a.a. ~ 215 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (49.39 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HMGB1 monoclonal antibody (M02), clone 1D5 Western Blot analysis of HMGB1 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M02), clone 1D5.
Lane 1: HMGB1 transfected lysate(24.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma tissue. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HMGB1 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HMGB1
Entrez GeneID
3146GeneBank Accession#
BC003378Protein Accession#
AAH03378.1Gene Name
HMGB1
Gene Alias
DKFZp686A04236, HMG1, HMG3, SBP-1
Gene Description
high-mobility group box 1
Omim ID
163905Gene Ontology
HyperlinkOther Designations
Amphoterin|OTTHUMP00000018199|OTTHUMP00000190860|Sulfoglucuronyl carbohydrate binding protein|high mobility group box 1|high mobility group protein 1|high-mobility group (nonhistone chromosomal) protein 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Extracellular HMGB1 blockade inhibits tumor growth through profoundly remodeling immune microenvironment and enhances checkpoint inhibitor-based immunotherapy.
Pascale Hubert, Patrick Roncarati, Stephanie Demoulin, Charlotte Pilard, Marie Ancion, Celia Reynders, Thomas Lerho, Diane Bruyere, Alizee Lebeau, Coraline Radermecker, Margot Meunier, Marie-Julie Nokin, Elodie Hendrick, Olivier Peulen, Philippe Delvenne, Michael Herfs.
Journal for Immunotherapy of Cancer 2021 Mar; 9(3):e001966.
Application:ICC, IHC-P, Human, Human breast cancers, Human mammary epithelial cells, Human normal mammary glands, Hs578T, MCF-7, MCF10A, MDA-MB-468, T-47D cells.
-
HMGB1 secretion during cervical carcinogenesis promotes the acquisition of a tolerogenic functionality by plasmacytoid dendritic cells.
Demoulin S, Herfs M, Somja J, Roncarati P, Delvenne P, Hubert P.
International Journal of Cancer 2015 Jul; 137(2):345.
Application:IF, IHC-P, Human, Cervical tissue samples included normal exocervical tissues, epithelial metaplasia, low-grade squamous intraepithelial lesion, high-grade squamous intraepithelial lesion and squamous cell carcinoma..
-
High expression of high-mobility group box 1 in the blood and lungs is associated with the development of chronic obstructive pulmonary disease in smokers.
Ko HK, Hsu WH, Hsieh CC, Lien TC, Lee TS, Kou YR.
Respirology 2014 Feb; 19(2):253.
Application:IHC-P, Human, Lung.
-
TLR4, IL-6, IL-18, MyD88 and HMGB1 are highly expressed in intracranial inflammatory lesions and the IgG4/IgG ratio correlates with TLR4 and IL-6.
Hirano H, Yoshioka T, Yunoue S, Fujio S, Yonezawa H, Niiro T, Habu M, Oyoshi T, Sugata S, Kamezawa T, Arimura H, Hanaya R, Tokimura H, Tokudome M, Arita K.
0 2012 Dec; 32(6):628.
Application:IF, IHC-P, Human, Human brain.
-
Human IgG antibody profiles differentiate between symptomatic patients with and without colorectal cancer.
Kijanka G, Hector S, Kay EW, Murray F, Cummins R, Murphy D, Maccraith BD, Prehn JH, Kenny D.
Gut 2010 Jan; 59(1):69.
Application:IHC-P, Human, Human colorectal cancer.
-
Donor Toll-like receptor 4 contributes to ischemia and reperfusion injury following human kidney transplantation.
Kruger B, Krick S, Dhillon N, Lerner SM, Ames S, Bromberg JS, Lin M, Walsh L, Vella J, Fischereder M, Kramer BK, Colvin RB, Heeger PS, Murphy BT, Schroppel B.
Proceedings of the National Academy of Sciences of the United States of America 2009 Mar; 106(9):3390.
Application:IF, Human, Kidney.
-
Extracellular HMGB1 blockade inhibits tumor growth through profoundly remodeling immune microenvironment and enhances checkpoint inhibitor-based immunotherapy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com