COMT MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human COMT protein.
Immunogen
COMT (NP_009294.1, 1 a.a. ~ 221 a.a) full-length human protein.
Sequence
MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Tissue lysate)
COMT MaxPab polyclonal antibody. Western Blot analysis of COMT expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of COMT expression in transfected 293T cell line (H00001312-T01) by COMT MaxPab polyclonal antibody.
Lane 1: COMT transfected lysate(24.31 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — COMT
Entrez GeneID
1312GeneBank Accession#
NM_007310.1Protein Accession#
NP_009294.1Gene Name
COMT
Gene Alias
-
Gene Description
catechol-O-methyltransferase
Gene Ontology
HyperlinkGene Summary
Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq
Other Designations
-
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Disturbed expression of phases I and II estrogen-metabolizing enzymes in endometrial cancer: Lower levels of CYP1B1 and increased expression of S-COMT.
Hevir N, Sinkovec J, Rizner TL.
Molecular and Cellular Endocrinology 2011 Jan; 331(1):158.
Application:IHC-P, Human, Human endometrial cancer.
-
Disturbed expression of phases I and II estrogen-metabolizing enzymes in endometrial cancer: Lower levels of CYP1B1 and increased expression of S-COMT.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com