Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CD99 MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00004267-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CD99 protein.
  • Immunogen:
  • CD99 (NP_002405.1, 1 a.a. ~ 185 a.a) full-length human protein.
  • Sequence:
  • MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CD99 MaxPab polyclonal antibody. Western Blot analysis of CD99 expression in human spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CD99 expression in transfected 293T cell line (H00004267-T01) by CD99 MaxPab polyclonal antibody.

    Lane 1: CD99 transfected lysate(20.35 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4267
  • Gene Name:
  • CD99
  • Gene Alias:
  • MIC2,MIC2X,MIC2Y
  • Gene Description:
  • CD99 molecule
  • Gene Summary:
  • The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. Cyclophilin A binds to CD99 and may act as a signaling regulator of CD99. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CD99 antigen,E2 antigen,MIC2 (monoclonal antibody 12E7),OTTHUMP00000022840,T-cell surface glycoprotein E2,antigen identified by monoclonal 12E7, Y homolog,antigen identified by monoclonal antibodies 12E7, F21 and O13,surface antigen MIC2
  • RSS
  • YouTube
  • Linkedin
  • Facebook