ABHD5 monoclonal antibody (M02), clone 4B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ABHD5.
Immunogen
ABHD5 (NP_057090, 240 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ABHD5 monoclonal antibody (M02), clone 4B12 Western Blot analysis of ABHD5 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ABHD5 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — ABHD5
Entrez GeneID
51099GeneBank Accession#
NM_016006Protein Accession#
NP_057090Gene Name
ABHD5
Gene Alias
CDS, CGI58, IECN2, MGC8731, NCIE2
Gene Description
abhydrolase domain containing 5
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. [provided by RefSeq
Other Designations
-
-
Interactome
-
Publication Reference
-
The Cannabinoid Receptor Agonist THC Attenuates Weight Loss in a Rodent Model of Activity-Based Anorexia.
Verty AN, Evetts MJ, Crouch GJ, McGregor IS, Stefanidis A, Oldfield BJ.
Neuropsychopharmacology 2011 Mar; 36:1349.
Application:WB-Ti, Rat, Brown, White adipose tissue.
-
Adipose triacylglycerol lipase deletion alters whole body energy metabolism and impairs exercise performance in mice.
Huijsman E, van de Par C, Economou C, van der Poel C, Lynch GS, Schoiswohl G, Haemmerle G, Zechner R, Watt MJ.
American Journal of Physiology. Endocrinology and Metabolism 2009 Aug; 297(2):E505.
Application:WB, Mouse, Muscle, adipose.
-
Adipose Triglyceride Lipase Regulation of Skeletal Muscle Lipid Metabolism and Insulin Responsiveness.
Watt MJ, van Denderen BJ, Castelli LA, Bruce CR, Hoy AJ, Kraegen EW, Macaulay L, Kemp BE.
Molecular Endocrinology (Baltimore, Md.) 2008 Jan; 22(5):1200.
Application:WB-Ti, WB-Tr, Mouse, Mouse muscle, C2C12 cells.
-
The Cannabinoid Receptor Agonist THC Attenuates Weight Loss in a Rodent Model of Activity-Based Anorexia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com