KLF8 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human KLF8 protein.
Immunogen
KLF8 (NP_009181.2, 1 a.a. ~ 359 a.a) full-length human protein.
Sequence
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKVYTKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLSLHRRRHDTM
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
KLF8 MaxPab rabbit polyclonal antibody. Western Blot analysis of KLF8 expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of KLF8 expression in transfected 293T cell line (H00011279-T01) by KLF8 MaxPab polyclonal antibody.
Lane 1: KLF8 transfected lysate(39.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — KLF8
Entrez GeneID
11279GeneBank Accession#
NM_007250.3Protein Accession#
NP_009181.2Gene Name
KLF8
Gene Alias
BKLF3, DKFZp686O08126, DXS741, MGC138314, ZNF741
Gene Description
Kruppel-like factor 8
Omim ID
300286Gene Ontology
HyperlinkGene Summary
This gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in the regulation of epithelial to mesenchymal transition, a process which occurs normally during development but also during metastasis. A pseudogene has been identified on chromosome 16. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
zinc finger protein 741
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com