SMAD1 purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00004086-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship in 3 months
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of SMAD1 expression in transfected 293T cell line (H00004086-T01) by SMAD1 MaxPab polyclonal antibody.

Lane 1: SMAD1 transfected lysate(52.30 KDa).
Lane 2: Non-transfected lysate.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between SMAD1 and GLI3. HeLa cells were stained with anti-SMAD1 rabbit purified polyclonal 1:1200 and anti-GLI3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

  • Specifications

    Product Description

    Rabbit polyclonal antibody raised against a full-length human SMAD1 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    SMAD1 (NP_001003688.1, 1 a.a. ~ 465 a.a) full-length human protein.

    Sequence

    MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS

    Host

    Rabbit

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (99)

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Transfected lysate)

    Western Blot analysis of SMAD1 expression in transfected 293T cell line (H00004086-T01) by SMAD1 MaxPab polyclonal antibody.

    Lane 1: SMAD1 transfected lysate(52.30 KDa).
    Lane 2: Non-transfected lysate.

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between SMAD1 and GLI3. HeLa cells were stained with anti-SMAD1 rabbit purified polyclonal 1:1200 and anti-GLI3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — SMAD1

    Entrez GeneID

    4086

    GeneBank Accession#

    NM_001003688

    Protein Accession#

    NP_001003688.1

    Gene Name

    SMAD1

    Gene Alias

    BSP1, JV4-1, JV41, MADH1, MADR1

    Gene Description

    SMAD family member 1

    Omim ID

    601595

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq

    Other Designations

    MAD, mothers against decapentaplegic homolog 1|Mad-related protein 1|SMAD, mothers against DPP homolog 1|Sma- and Mad-related protein 1|TGF-beta signaling protein 1|mothers against DPP homolog 1|transforming growth factor-beta signaling protein 1

  • Interactomes
  • Pathways
  • Diseases
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All