SMAD1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Rabbit polyclonal antibody raised against a full-length human SMAD1 protein.
Immunogen
SMAD1 (NP_001003688.1, 1 a.a. ~ 465 a.a) full-length human protein.
Sequence
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SMAD1 expression in transfected 293T cell line (H00004086-T01) by SMAD1 MaxPab polyclonal antibody.
Lane 1: SMAD1 transfected lysate(52.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between SMAD1 and GLI3. HeLa cells were stained with anti-SMAD1 rabbit purified polyclonal 1:1200 and anti-GLI3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — SMAD1
Entrez GeneID
4086GeneBank Accession#
NM_001003688Protein Accession#
NP_001003688.1Gene Name
SMAD1
Gene Alias
BSP1, JV4-1, JV41, MADH1, MADR1
Gene Description
SMAD family member 1
Omim ID
601595Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq
Other Designations
MAD, mothers against decapentaplegic homolog 1|Mad-related protein 1|SMAD, mothers against DPP homolog 1|Sma- and Mad-related protein 1|TGF-beta signaling protein 1|mothers against DPP homolog 1|transforming growth factor-beta signaling protein 1
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com