HDAC1 monoclonal antibody (M14), clone 5C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HDAC1.
Immunogen
HDAC1 (AAH00301, 1 a.a. ~ 482 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (78.76 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HDAC1 monoclonal antibody (M14), clone 5C11. Western Blot analysis of HDAC1 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
HDAC1 monoclonal antibody (M14), clone 5C11. Western Blot analysis of HDAC1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
HDAC1 monoclonal antibody (M14), clone 5C11 Western Blot analysis of HDAC1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
HDAC1 monoclonal antibody (M14), clone 5C11. Western Blot analysis of HDAC1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of HDAC1 expression in transfected 293T cell line by HDAC1 monoclonal antibody (M14), clone 5C11.
Lane 1: HDAC1 transfected lysate(55.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between NFKB1 and HDAC1. HeLa cells were stained with anti-NFKB1 rabbit purified polyclonal 1:1200 and anti-HDAC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HDAC1
Entrez GeneID
3065GeneBank Accession#
BC000301Protein Accession#
AAH00301Gene Name
HDAC1
Gene Alias
DKFZp686H12203, GON-10, HD1, RPD3, RPD3L1
Gene Description
histone deacetylase 1
Omim ID
601241Gene Ontology
HyperlinkGene Summary
Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq
Other Designations
OTTHUMP00000008745|reduced potassium dependency, yeast homolog-like 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The cell- and tissue-specific transcription mechanism of the TATA-less syntaxin 1A gene.
Nakayama T, Mikoshiba K, Akagawa K.
FASEB Journal 2016 Feb; 30(2):525.
Application:IP, WB, Rat, PC12, FRSK cells.
-
The cell- and tissue-specific transcription mechanism of the TATA-less syntaxin 1A gene.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com