UCHL1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human UCHL1.
Immunogen
Recombinant protein corresponding to human UCHL1.
Sequence
QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-5000)
Western Blot (1:500-1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot (Tissue lysate) analysis of mouse cerebral cortex.Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis of (1) NIH-3T3 cell lysate and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons and in neuropil.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in peripheral ganglion and peripheral nerves.Immunofluorescence
Immunofluorescent staining of U-251MG cell line with antibody shows positivity in nucleoplasm and cytosol (green). -
Gene Info — UCHL1
Entrez GeneID
7345Protein Accession#
P09936Gene Name
UCHL1
Gene Alias
PARK5, PGP9.5, Uch-L1
Gene Description
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease
Other Designations
ubiquitin C-terminal esterase L1|ubiquitin carboxyl-terminal esterase L1|ubiquitin thiolesterase L1
-
Interactome
-
Disease
-
Publication Reference
-
UCH-LI acts as a novel prognostic biomarker in gastric cardiac adenocarcinoma.
Yang H, Zhang C, Fang S, Ou R, Li W, Xu Y.
International Journal of Clinical and Experimental Pathology 2015 Nov; 8(11):13957.
Application:IHC-P, WB-Tr, Human, Human gastric cardiac adenocarcinoma, MGC803, MKN45 cells.
-
The prognostic potential and oncogenic effects of PRR11 expression in hilar cholangiocarcinoma.
Chen Y, Cha Z, Fang W, Qian B, Yu W, Li W, Yu G, Gao Y.
Oncotarget 2015 Aug; 6(24):20419.
Application:IHC-P, WB-Tr, Human, Human hilar cholangiocarcinoma, Human tissue microarray, QBC939 cells.
-
Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets.
Lindskog C, Asplund A, Engkvist M, Uhlen M, Korsgren O, Ponten F.
Discovery Medicine 2010 Jun; 9(49):565.
-
UCH-LI acts as a novel prognostic biomarker in gastric cardiac adenocarcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com