FGF9 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Result of activity analysis
Result of activity analysis
-
Specification
Product Description
Human FGF9 (P31371, 1 a.a. - 208 a.a ) full-length recombinant protein expressed in Escherichia coli.
Sequence
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Host
Escherichia coli
Theoretical MW (kDa)
23.4
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purity
> 95% as analyzed by SDS-PAGE.
> 95% as analyzed by HPLC.Endotoxin Level
< 0.2 EU/ug of protein by gel clotting method
Activity
ED50 < 2.0 ng/mL , measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 5.0× 105 units/mg.
Recommend Usage
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Storage Instruction
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — FGF9
Entrez GeneID
2254Protein Accession#
P31371Gene Name
FGF9
Gene Alias
GAF, HBFG-9, MGC119914, MGC119915
Gene Description
fibroblast growth factor 9 (glia-activating factor)
Omim ID
600921Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. [provided by RefSeq
Other Designations
OTTHUMP00000018804|fibroblast growth factor 9|glia-activating factor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com