RIPK2 monoclonal antibody (M02), clone 6F7

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant RIPK2.
Immunogen
RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (84); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RIPK2 monoclonal antibody (M02), clone 6F7 Western Blot analysis of RIPK2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RIPK2 expression in transfected 293T cell line by RIPK2 monoclonal antibody (M02), clone 6F7.
Lane 1: RIPK2 transfected lysate(61.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RIPK2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RIPK2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — RIPK2
Entrez GeneID
8767GeneBank Accession#
BC004553Protein Accession#
AAH04553Gene Name
RIPK2
Gene Alias
CARD3, CARDIAK, CCK, GIG30, RICK, RIP2
Gene Description
receptor-interacting serine-threonine kinase 2
Omim ID
603455Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq
Other Designations
CARD-carrying kinase|CARD-containing interleukin-1 beta-converting enzyme (ICE)-associated kinase|growth-inhibiting gene 30|receptor interacting protein 2|receptor-interacting protein (RIP)-like interacting caspase-like apoptosis regulatory protein (CLARP
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
NOD/RIPK2 signalling pathway contributes to osteoarthritis susceptibility.
Michael J Jurynec, Catherine M Gavile, Matthew Honeggar, Ying Ma, Shivakumar R Veerabhadraiah, Kendra A Novak, Kazuyuki Hoshijima, Nikolas H Kazmers, David J Grunwald.
Annals of the Rheumatic Diseases 2022 Oct; 81(10):1465.
Application:IHC, Mouse, Knee joint.
-
Rip2 Is Required for Nod2-Mediated Lysozyme Sorting in Paneth Cells.
Wang H, Zhang X, Zuo Z, Zhang Q, Pan Y, Zeng B, Li W, Wei H, Liu Z.
Amino Acids 2017 Mar; 198(9):3729.
Application:WB, Mouse, Paneth cells.
-
LRRK2 enhances Nod1/2-mediated inflammatory cytokine production by promoting Rip2 phosphorylation.
Yan R, Liu Z.
Protein & Cell 2017 Jan; 8(1):55.
Application:WB, Human, Mouse, BMDM, THP-1 cells.
-
NOD/RIPK2 signalling pathway contributes to osteoarthritis susceptibility.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com