RIPK2 monoclonal antibody (M02), clone 6F7

Catalog # H00008767-M02

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in PC-12 ( Cat # L012V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RIPK2 monoclonal antibody (M02), clone 6F7 Western Blot analysis of RIPK2 expression in HeLa ( Cat # L013V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in NIH/3T3 ( Cat # L018V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in Raw 264.7 ( Cat # L024V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of RIPK2 expression in transfected 293T cell line by RIPK2 monoclonal antibody (M02), clone 6F7.

Lane 1: RIPK2 transfected lysate(61.2 KDa).
Lane 2: Non-transfected lysate.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to RIPK2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.2 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged RIPK2 is approximately 0.1ng/ml as a capture antibody.

QC Test

Western Blot detection against Immunogen (37.84 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant RIPK2.

    Immunogen

    RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Interspecies Antigen Sequence

    Mouse (84); Rat (85)

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (37.84 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in PC-12 ( Cat # L012V1 ).

    Western Blot (Cell lysate)

    RIPK2 monoclonal antibody (M02), clone 6F7 Western Blot analysis of RIPK2 expression in HeLa ( Cat # L013V1 ).

    Western Blot (Cell lysate)

    RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in NIH/3T3 ( Cat # L018V1 ).

    Western Blot (Cell lysate)

    RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in Raw 264.7 ( Cat # L024V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of RIPK2 expression in transfected 293T cell line by RIPK2 monoclonal antibody (M02), clone 6F7.

    Lane 1: RIPK2 transfected lysate(61.2 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to RIPK2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.2 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged RIPK2 is approximately 0.1ng/ml as a capture antibody.

    ELISA

  • Gene Info — RIPK2

    Entrez GeneID

    8767

    GeneBank Accession#

    BC004553

    Protein Accession#

    AAH04553

    Gene Name

    RIPK2

    Gene Alias

    CARD3, CARDIAK, CCK, GIG30, RICK, RIP2

    Gene Description

    receptor-interacting serine-threonine kinase 2

    Omim ID

    603455

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq

    Other Designations

    CARD-carrying kinase|CARD-containing interleukin-1 beta-converting enzyme (ICE)-associated kinase|growth-inhibiting gene 30|receptor interacting protein 2|receptor-interacting protein (RIP)-like interacting caspase-like apoptosis regulatory protein (CLARP

  • Interactome
  • Pathway
  • Disease
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All