SORT1 monoclonal antibody (M01), clone 1B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SORT1.
Immunogen
SORT1 (NP_002950, 203 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SORT1 monoclonal antibody (M01), clone 1B3. Western Blot analysis of SORT1 expression in rat brain.Western Blot (Tissue lysate)
SORT1 monoclonal antibody (M01), clone 1B3. Western Blot analysis of SORT1 expression in human placenta.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SORT1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — SORT1
Entrez GeneID
6272GeneBank Accession#
NM_002959Protein Accession#
NP_002950Gene Name
SORT1
Gene Alias
Gp95, NT3
Gene Description
sortilin 1
Omim ID
602458Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a multi-ligand type-1 receptor with similarity to the yeast carboxypeptidase Y sorting receptor Vps10 protein. The encoded protein, a trans-Golgi network (TGN) transmembrane protein, binds a number of unrelated ligands that participate in a wide range of cellular processes; however, it lacks the typical features of a signalling receptor. In the TGN, furin mediates the activation of the mature binding form. The encoded protein consists of a large luminal domain, a single transmembrane segment and short C-terminal cytoplasmic tail. The luminal domain contains a cysteine-rich region similar to two corresponding segments in the yeast Vps10p; the cytoplasmic tail is similar to the corresponding segment of the cation-independent mannose 6-phosphate receptor and the tail also interacts with the VHS domains of GGA (Golgi-associated, gamma-adaptin homologous, ARF-interacting) proteins. [provided by RefSeq
Other Designations
OTTHUMP00000013784|neurotensin receptor 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com