NME1 monoclonal antibody (M02), clone 1D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in different cell lines.
Western Blot (Cell lysate)
NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in HeLa(Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of NME1 expression in transfected 293T cell line by NME1 monoclonal antibody (M02), clone 1D7.
Lane 1: NME1 transfected lysate(19.7 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of NME1 transfected lysate using anti-NME1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NME1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NME1 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant NME1.
Immunogen
NME1 (NP_000260, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in different cell lines.Western Blot (Cell lysate)
NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in HeLa(Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NME1 expression in transfected 293T cell line by NME1 monoclonal antibody (M02), clone 1D7.
Lane 1: NME1 transfected lysate(19.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of NME1 transfected lysate using anti-NME1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NME1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NME1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NME1
Entrez GeneID
4830GeneBank Accession#
NM_000269Protein Accession#
NP_000260Gene Name
NME1
Gene Alias
AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1
Gene Description
non-metastatic cells 1, protein (NM23A) expressed in
Gene Ontology
HyperlinkGene Summary
This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
Other Designations
NDP kinase A|OTTHUMP00000174772
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
A transcriptome-based protein network that identifies new therapeutic targets in colorectal cancer.
Durand S, Trillet K, Uguen A, Saint-Pierre A, Le Jossic-Corcos C, Corcos L.
BMC Genomics 2017 Sep; 18(1):758.
Application：IHC-P, WB-Ti, Human, Human colon cancer.
-
Identification of Antigenic Proteins Associated with Trichloroethylene-Induced Autoimmune Disease by Serological Proteome Analysis.
Liu J, Xing X, Huang H, Jiang Y, He H, Xu X, Yuan J, Zhou L, Yang L, Zhuang Z.
Toxicology and Applied Pharmacology 2009 Nov; 240(3):393.
Application：WB-Ce, Human, TCE-treated L-02 liver cells.
-
A transcriptome-based protein network that identifies new therapeutic targets in colorectal cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com