KCNE1 monoclonal antibody (M13), clone 2A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant KCNE1.
Immunogen
KCNE1 (AAH36452, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunoprecipitation
Immunoprecipitation of KCNE1 transfected lysate using anti-KCNE1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KCNE1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — KCNE1
Entrez GeneID
3753GeneBank Accession#
BC036452Protein Accession#
AAH36452Gene Name
KCNE1
Gene Alias
FLJ18426, FLJ38123, FLJ94103, ISK, JLNS, JLNS2, LQT2/5, LQT5, MGC33114, MinK
Gene Description
potassium voltage-gated channel, Isk-related family, member 1
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
IKs producing slow voltage-gated potassium channel subunit beta Mink|OTTHUMP00000108623|OTTHUMP00000108625|OTTHUMP00000108626|cardiac delayed rectifier potassium channel protein|delayed rectifier potassium channel subunit IsK|minimal potassium channel|pot
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com