![](/upload/media/product/tag/abnova-maxpab-tag.png)
KCNE1 MaxPab mouse polyclonal antibody (B01)
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human KCNE1 protein.
Immunogen
KCNE1 (NP_000210.2, 1 a.a. ~ 129 a.a) full-length human protein.
Sequence
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KCNE1 expression in transfected 293T cell line (H00003753-T01) by KCNE1 MaxPab polyclonal antibody.
Lane 1: KCNE1 transfected lysate(14.19 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — KCNE1
Entrez GeneID
3753GeneBank Accession#
NM_000219.2Protein Accession#
NP_000210.2Gene Name
KCNE1
Gene Alias
FLJ18426, FLJ38123, FLJ94103, ISK, JLNS, JLNS2, LQT2/5, LQT5, MGC33114, MinK
Gene Description
potassium voltage-gated channel, Isk-related family, member 1
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
IKs producing slow voltage-gated potassium channel subunit beta Mink|OTTHUMP00000108623|OTTHUMP00000108625|OTTHUMP00000108626|cardiac delayed rectifier potassium channel protein|delayed rectifier potassium channel subunit IsK|minimal potassium channel|pot
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com