ITPA monoclonal antibody (M01), clone 2H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ITPA.
Immunogen
ITPA (NP_258412.1, 89 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITPA is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — ITPA
Entrez GeneID
3704GeneBank Accession#
NM_033453Protein Accession#
NP_258412.1Gene Name
ITPA
Gene Alias
C20orf37, HLC14-06-P, ITPase, dJ794I6.3
Gene Description
inosine triphosphatase (nucleoside triphosphate pyrophosphatase)
Omim ID
147520Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene hydrolyzes inosine triphosphate and deoxyinosine triphosphate to the monophosphate nucleotide and diphosphate. The encoded protein, which is a member of the HAM1 NTPase protein family, is found in the cytoplasm and acts as a homodimer. Defects in the encoded protein can result in inosine triphosphate pyrophosphorylase deficiency. Two transcript variants encoding two different isoforms have been found for this gene. Also, at least two other transcript variants have been identified which are probably regulatory rather than protein-coding. [provided by RefSeq
Other Designations
My049 protein|OTTHUMP00000030094|inosine triphosphatase|inosine triphosphatase-A|inosine triphosphate pyrophosphatase|inosine triphosphate pyrophosphohydrolase|nucleoside triphosphate diphosphatase|putative oncogene protein HLC14-06-P
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A novel multiparameter flow cytometric assay for inosine triphosphatase expression analysis in leukocytes.
Vroemen WH, Munnix IC, Bakker JA, Bierau J, Huts M, Leers MP.
Cytometry. Part A : the Journal of the International Society for Analytical Cytology 2012 Aug; 81(8):672.
Application:ICC, Human, Human leukocytes.
-
A novel multiparameter flow cytometric assay for inosine triphosphatase expression analysis in leukocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com