ILK monoclonal antibody (M01), clone 4F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ILK.
Immunogen
ILK (AAH01554, 341 a.a. ~ 452 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.06 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ILK monoclonal antibody (M01), clone 4F10 Western Blot analysis of ILK expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
ILK monoclonal antibody (M01), clone 4F10. Western Blot analysis of ILK expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
ILK monoclonal antibody (M01), clone 4F10. Western Blot analysis of ILK expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
ILK monoclonal antibody (M01), clone 4F10. Western Blot analysis of ILK expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
ILK monoclonal antibody (M01), clone 4F10. Western Blot analysis of ILK expression in NIH/3T3(Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ILK expression in transfected 293T cell line by ILK monoclonal antibody (M01), clone 4F10.
Lane 1: ILK transfected lysate(51.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ILK is approximately 3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ILK over-expressed 293 cell line, cotransfected with ILK Validated Chimera RNAi ( Cat # H00003611-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ILK monoclonal antibody (M01) clone 4F10 (Cat # H00003611-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to ILK on Jurkat cell . [antibody concentration 10 ug/ml] -
Gene Info — ILK
Entrez GeneID
3611GeneBank Accession#
BC001554Protein Accession#
AAH01554Gene Name
ILK
Gene Alias
DKFZp686F1765, P59
Gene Description
integrin-linked kinase
Omim ID
602366Gene Ontology
HyperlinkGene Summary
Transduction of extracellular matrix signals through integrins influences intracellular and extracellular functions, and appears to require interaction of integrin cytoplasmic domains with cellular proteins. Integrin-linked kinase (ILK), interacts with the cytoplasmic domain of beta-1 integrin. This gene encodes a serine/threonine protein kinase with 4 ankyrin-like repeats, which associates with the cytoplasmic domain of beta integrins and acts as a proximal receptor kinase regulating integrin-mediated signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com