IFNG MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human IFNG protein.
Immunogen
IFNG (NP_000610, 1 a.a. ~ 166 a.a) full-length human protein.
Sequence
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (41); Rat (39)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IFNG expression in transfected 293T cell line (H00003458-T02) by IFNG MaxPab polyclonal antibody.
Lane 1: IFNG transfected lysate(18.26 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IFNG
Entrez GeneID
3458GeneBank Accession#
NM_000619Protein Accession#
NP_000610Gene Name
IFNG
Gene Alias
IFG, IFI
Gene Description
interferon, gamma
Gene Ontology
HyperlinkGene Summary
Interferon-gamma (IFNG), or type II interferon, is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFNG in the immune system stems in part from its ability to inhibit viral replication directly, but most importantly derives from its immunostimulatory and immunomodulatory effects. IFNG is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 (MIM 186940) and CD8 (see MIM 186910) cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops (Schoenborn and Wilson, 2007 [PubMed 17981204]).[supplied by OMIM
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Targeting a newly established spontaneous feline fibrosarcoma cell line by gene transfer.
Nande R, Di Benedetto A, Aimola P, De Carlo F, Carper M, Claudio CD, Denvir J, Valluri J, Duncan GC, Claudio PP.
PLoS One 2012 May; 7(5):e37743.
Application:WB, Human, Cocca-6A cells.
-
Targeting a newly established spontaneous feline fibrosarcoma cell line by gene transfer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com