HDAC1 monoclonal antibody (M14), clone 5C11

Catalog # H00003065-M14

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship in 3 months
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

HDAC1 monoclonal antibody (M14), clone 5C11 Western Blot analysis of HDAC1 expression in Hela S3 NE ( Cat # L013V3 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

HDAC1 monoclonal antibody (M14), clone 5C11. Western Blot analysis of HDAC1 expression in NIH/3T3 ( Cat # L018V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

HDAC1 monoclonal antibody (M14), clone 5C11. Western Blot analysis of HDAC1 expression in PC-12 ( Cat # L012V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

HDAC1 monoclonal antibody (M14), clone 5C11. Western Blot analysis of HDAC1 expression in Raw 264.7 ( Cat # L024V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of HDAC1 expression in transfected 293T cell line by HDAC1 monoclonal antibody (M14), clone 5C11.

Lane 1: HDAC1 transfected lysate(55.1 KDa).
Lane 2: Non-transfected lysate.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between NFKB1 and HDAC1. HeLa cells were stained with anti-NFKB1 rabbit purified polyclonal 1:1200 and anti-HDAC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Immunofluorescence
Application

Immunofluorescence

Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml]

QC Test

Western Blot detection against Immunogen (78.76 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a full length recombinant HDAC1.

    Immunogen

    HDAC1 (AAH00301, 1 a.a. ~ 482 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Interspecies Antigen Sequence

    Mouse (99); Rat (99)

    Isotype

    IgG1 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (78.76 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    HDAC1 monoclonal antibody (M14), clone 5C11 Western Blot analysis of HDAC1 expression in Hela S3 NE ( Cat # L013V3 ).

    Western Blot (Cell lysate)

    HDAC1 monoclonal antibody (M14), clone 5C11. Western Blot analysis of HDAC1 expression in NIH/3T3 ( Cat # L018V1 ).

    Western Blot (Cell lysate)

    HDAC1 monoclonal antibody (M14), clone 5C11. Western Blot analysis of HDAC1 expression in PC-12 ( Cat # L012V1 ).

    Western Blot (Cell lysate)

    HDAC1 monoclonal antibody (M14), clone 5C11. Western Blot analysis of HDAC1 expression in Raw 264.7 ( Cat # L024V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of HDAC1 expression in transfected 293T cell line by HDAC1 monoclonal antibody (M14), clone 5C11.

    Lane 1: HDAC1 transfected lysate(55.1 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.

    ELISA

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between NFKB1 and HDAC1. HeLa cells were stained with anti-NFKB1 rabbit purified polyclonal 1:1200 and anti-HDAC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

    Immunofluorescence

    Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml]
  • Gene Info — HDAC1

    Entrez GeneID

    3065

    GeneBank Accession#

    BC000301

    Protein Accession#

    AAH00301

    Gene Name

    HDAC1

    Gene Alias

    DKFZp686H12203, GON-10, HD1, RPD3, RPD3L1

    Gene Description

    histone deacetylase 1

    Omim ID

    601241

    Gene Ontology

    Hyperlink

    Gene Summary

    Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq

    Other Designations

    OTTHUMP00000008745|reduced potassium dependency, yeast homolog-like 1

  • Interactome
  • Pathway
  • Disease
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All