CRABP2 monoclonal antibody (M01), clone 4F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CRABP2.
Immunogen
CRABP2 (NP_001869.1, 1 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.1 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CRABP2 expression in transfected 293T cell line by CRABP2 monoclonal antibody (M01), clone 4F2.
Lane 1: CRABP2 transfected lysate(15.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRABP2 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CRABP2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CRABP2
Entrez GeneID
1382GeneBank Accession#
NM_001878.2Protein Accession#
NP_001869.1Gene Name
CRABP2
Gene Alias
CRABP-II, RBP6
Gene Description
cellular retinoic acid binding protein 2
Omim ID
180231Gene Ontology
HyperlinkGene Summary
A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 gene suggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein. [provided by RefSeq
Other Designations
OTTHUMP00000038730|OTTHUMP00000038732|cellular retinoic acid-binding protein 2
-
Interactome
-
Disease
-
Publication Reference
-
Downregulation of CRABP2 Inhibit the Tumorigenesis of Hepatocellular Carcinoma In Vivo and In Vitro.
Qingmin Chen, Ludong Tan, Zhe Jin, Yahui Liu, Ze Zhang.
BioMed Research International 2020 Jun; 2020:3098327.
Application:IF, Human, HepG2 cells.
-
CRABP2 regulates invasion and metastasis of breast cancer through hippo pathway dependent on ER status.
Feng X, Zhang M, Wang B, Zhou C, Mu Y, Li J, Liu X, Wang Y, Song Z, Liu P.
Journal of Experimental & Clinical Cancer Research 2019 Aug; 38(1):361.
Application:IHC-P, IF, Human, Breast cancer, MDA-MB-231, T47D, BT549 cells.
-
Downregulation of CRABP2 Inhibit the Tumorigenesis of Hepatocellular Carcinoma In Vivo and In Vitro.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com