CAMLG purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CAMLG protein.
Immunogen
CAMLG (NP_001736.1, 1 a.a. ~ 296 a.a) full-length human protein.
Sequence
MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CAMLG MaxPab rabbit polyclonal antibody. Western Blot analysis of CAMLG expression in human spleen.Western Blot (Cell lysate)
CAMLG MaxPab rabbit polyclonal antibody. Western Blot analysis of CAMLG expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of CAMLG expression in transfected 293T cell line (H00000819-T01) by CAMLG MaxPab polyclonal antibody.
Lane 1: CAMLG transfected lysate(33.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CAMLG
Entrez GeneID
819GeneBank Accession#
NM_001745.2Protein Accession#
NP_001736.1Gene Name
CAMLG
Gene Alias
CAML, MGC163197
Gene Description
calcium modulating ligand
Omim ID
601118Gene Ontology
HyperlinkGene Summary
The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [provided by RefSeq
Other Designations
calcium-modulating cyclophilin ligand|calcium-signal modulating cyclophilin ligand|cyclophilin B-binding protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com