CA1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CA1 protein.
Immunogen
CA1 (NP_001729.1, 1 a.a. ~ 261 a.a) full-length human protein.
Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (78); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA1 expression in human placenta.Western Blot (Tissue lysate)
CA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA1 expression in mouse brain.Western Blot (Tissue lysate)
CA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA1 expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of CA1 expression in transfected 293T cell line (H00000759-T01) by CA1 MaxPab polyclonal antibody.
Lane 1: CA1 transfected lysate(28.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CA1
Entrez GeneID
759GeneBank Accession#
NM_001738.1Protein Accession#
NP_001729.1Gene Name
CA1
Gene Alias
Car1
Gene Description
carbonic anhydrase I
Omim ID
114800Gene Ontology
HyperlinkGene Summary
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Variants of this gene have been described in some populations. Multiple alternatively spliced variants, encoding the same protein, have been identified. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature. [provided by RefSeq
Other Designations
carbonic dehydratase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com