AKT1 monoclonal antibody (M01), clone 4C3
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant AKT1.
Immunogen
AKT1 (AAH00479, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunoprecipitation
Immunoprecipitation of AKT1 transfected lysate using anti-AKT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AKT1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKT1 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of AKT1 over-expressed 293 cell line, cotransfected with AKT1 Validated Chimera RNAi ( Cat # H00000207-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AKT1 monoclonal antibody (M01) clone 4C3 (Cat # H00000207-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.RNAi Knockdown (Antibody validated)
Western blot analysis of AKT1 over-expressed 293 cell line, cotransfected with AKT1 Validated Chimera RNAi ( Cat # H00000207-R02V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AKT1 monoclonal antibody (M01) clone 4C3 (Cat # H00000207-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between APPL1 and AKT1. HeLa cells were stained with anti-APPL1 rabbit purified polyclonal 1:1200 and anti-AKT1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — AKT1
Entrez GeneID
207GeneBank Accession#
BC000479Protein Accession#
AAH00479Gene Name
AKT1
Gene Alias
AKT, MGC99656, PKB, PKB-ALPHA, PRKBA, RAC, RAC-ALPHA
Gene Description
v-akt murine thymoma viral oncogene homolog 1
Gene Ontology
HyperlinkGene Summary
The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
RAC-alpha serine/threonine-protein kinase|murine thymoma viral (v-akt) oncogene homolog-1|protein kinase B|rac protein kinase alpha
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
miR-21 regulates the proliferation and apoptosis of ovarian cancer cells through PTEN/PI3K/AKT.
Liu HY, Zhang YY, Zhu BL, Feng FZ, Yan H, Zhang HY, Zhou B.
European Review for Medical and Pharmacological Sciences 2019 May; 23(10):4149.
Application:WB-Tr, Human, A2078, IOSE80, SKOV3 cells.
-
miR-21 regulates the proliferation and apoptosis of ovarian cancer cells through PTEN/PI3K/AKT.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com