AAMP monoclonal antibody (M02), clone 2H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AAMP is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant AAMP.
Immunogen
AAMP (NP_001078.2, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AAMP is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — AAMP
Entrez GeneID
14GeneBank Accession#
NM_001087Protein Accession#
NP_001078.2Gene Name
AAMP
Gene Alias
-
Gene Description
angio-associated, migratory cell protein
Omim ID
603488Gene Ontology
HyperlinkGene Summary
The gene product is an immunoglobulin-type protein. It is found to be expressed strongly in endothelial cells, cytotrophoblasts, and poorly differentiated colon adenocarcinoma cells found in lymphatics. The protein contains a heparin-binding domain and mediates heparin-sensitive cell adhesion. [provided by RefSeq
Other Designations
-
-
Interactomes
-
Publication Reference
-
The Impact of Angio-associated Migratory Cell Protein (AAMP) on Breast Cancer Cells In Vitro and Its Clinical Significance.
Yin Y, Sanders AJ, Jiang WG.
Anticancer Research 2013 Apr; 33(4):1499.
Application：IHC, WB-Tr, Human, Breast, MCF-7, MDA-MB-231 cells.
-
The Impact of Angio-associated Migratory Cell Protein (AAMP) on Breast Cancer Cells In Vitro and Its Clinical Significance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com