TOMM20 polyclonal antibody

Catalog # PAB31823

Size

Price

Stock

Quantity

Size:100 uL
Price: USD $ 428.00
Stock:
order now, ship in 5 days
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

Western blot analysis of mouse cell lines NIH-3T3.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

Western blot analysis of human cell lines HEK293 and MCF-7 using TOMM20 polyclonal antibody (Cat # PAB31823). Loading control: Anti-HSP90B1.

Immunohistochemistry
Application

Immunohistochemistry

Immunohistochemical staining of human endometrium shows strong positivity in mitochondrial in glandular cells.

Immunohistochemistry
Application

Immunohistochemistry

Immunohistochemical staining of human duodenum shows strong positivity in mitochondrial in glandular cells.

Immunohistochemistry
Application

Immunohistochemistry

Immunohistochemical staining of human prostate shows strong positivity in mitochondrial in glandular cells.

Immunohistochemistry
Application

Immunohistochemistry

Immunohistochemical staining of human cerebral cortex shows strong positivity in mitochondrial in neurons.

Immunofluorescence
Application

Immunofluorescence

Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondrial.

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against recombinant human TOMM20.

    Sequence

    KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL PTISQRIVSAQSLAEDDV

    Host

    Rabbit

    Reactivity

    Human, Mouse

    Specificity

    This antibody reacts to to TOMM20.

    Form

    Liquid

    Purification

    Affinity purification

    Isotype

    IgG

    Recommend Usage

    Immunofluorescence (0.25-2 ug/mL)
    Immunohistochemistry (1:500 - 1:1000)
    Western Blot (0.04-0.4 ug/mL)
    The optimal working dilution should be determined by the end user.

    Storage Buffer

    In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).

    Storage Instruction

    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.

    Note

    This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

  • Applications

    Western Blot (Cell lysate)

    Western blot analysis of mouse cell lines NIH-3T3.

    Western Blot (Cell lysate)

    Western blot analysis of human cell lines HEK293 and MCF-7 using TOMM20 polyclonal antibody (Cat # PAB31823). Loading control: Anti-HSP90B1.

    Immunohistochemistry

    Immunohistochemical staining of human endometrium shows strong positivity in mitochondrial in glandular cells.

    Immunohistochemistry

    Immunohistochemical staining of human duodenum shows strong positivity in mitochondrial in glandular cells.

    Immunohistochemistry

    Immunohistochemical staining of human prostate shows strong positivity in mitochondrial in glandular cells.

    Immunohistochemistry

    Immunohistochemical staining of human cerebral cortex shows strong positivity in mitochondrial in neurons.

    Immunofluorescence

    Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondrial.
  • Gene Info — TOMM20

    Entrez GeneID

    9804

    Gene Name

    TOMM20

    Gene Alias

    KIAA0016, MAS20, MGC117367, MOM19, TOM20

    Gene Description

    translocase of outer mitochondrial membrane 20 homolog (yeast)

    Omim ID

    601848

    Gene Ontology

    Hyperlink

    Other Designations

    OTTHUMP00000037593|translocase of outer mitochondrial membrane 20 homolog|translocase of outer mitochondrial membrane 20 homolog type II

  • Interactome
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All