UBQLN2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western Blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: human plasma (IgG/HSA depleted), Lane 4: human liver and Lane 5: human tonsil lysates with UBQLN2 polyclonal antibody (Cat # PAB30759).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with UBQLN2 polyclonal antibody (Cat # PAB30759) shows strong nuclear and cytoplasmic positivity in Purkinje cells, cells in molecular layer and cells in granular layer.
Immunofluorescence
Immunofluorescent staining of U-2 OS with UBQLN2 polyclonal antibody (Cat # PAB30759) (Green) shows positivity in plasma membrane and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human UBQLN2.
Immunogen
Recombinant protein corresponding to human UBQLN2.
Sequence
LSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLN
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: human plasma (IgG/HSA depleted), Lane 4: human liver and Lane 5: human tonsil lysates with UBQLN2 polyclonal antibody (Cat # PAB30759).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with UBQLN2 polyclonal antibody (Cat # PAB30759) shows strong nuclear and cytoplasmic positivity in Purkinje cells, cells in molecular layer and cells in granular layer.Immunofluorescence
Immunofluorescent staining of U-2 OS with UBQLN2 polyclonal antibody (Cat # PAB30759) (Green) shows positivity in plasma membrane and cytoplasm. -
Gene Info — UBQLN2
Entrez GeneID
29978Protein Accession#
Q9UHD9Gene Name
UBQLN2
Gene Alias
CHAP1, CHAP1/DSK2, Dsk2, HRIHFB2157, LIC-2, N4BP4, PLIC-2, PLIC2, RIHFB2157
Gene Description
ubiquilin 2
Omim ID
300264Gene Ontology
HyperlinkGene Summary
This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein. [provided by RefSeq
Other Designations
Nedd4 binding protein 4|bA431N15.1 (ubiquilin 2)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com