CENPH purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CENPH protein.
Immunogen
CENPH (NP_075060.1, 1 a.a. ~ 247 a.a) full-length human protein.
Sequence
MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (65)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CENPH MaxPab polyclonal antibody. Western Blot analysis of CENPH expression in NIH/3T3.Western Blot (Cell lysate)
CENPH MaxPab polyclonal antibody. Western Blot analysis of CENPH expression in Raw 264.7.Western Blot (Cell lysate)
CENPH MaxPab polyclonal antibody. Western Blot analysis of CENPH expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of CENPH expression in transfected 293T cell line (H00064946-T02) by CENPH MaxPab polyclonal antibody.
Lane 1: CENPH transfected lysate(27.17 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CENPH on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CENPH
Entrez GeneID
64946GeneBank Accession#
NM_022909Protein Accession#
NP_075060.1Gene Name
CENPH
Gene Alias
NNF1, PMF1
Gene Description
centromere protein H
Omim ID
605607Gene Ontology
HyperlinkGene Summary
Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. [provided by RefSeq
Other Designations
NNF1, MIND kinetochore complex component, homolog|kinetochore protein CENP-H
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com