FBXO42 monoclonal antibody (M02), clone 2F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FBXO42 monoclonal antibody (M02), clone 2F10 Western Blot analysis of FBXO42 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
FBXO42 monoclonal antibody (M02), clone 2F10. Western Blot analysis of FBXO42 expression in PC-12(Cat # L012V1 ).
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FBXO42.
Immunogen
FBXO42 (NP_061867, 619 a.a. ~ 717 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FBXO42 monoclonal antibody (M02), clone 2F10 Western Blot analysis of FBXO42 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
FBXO42 monoclonal antibody (M02), clone 2F10. Western Blot analysis of FBXO42 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — FBXO42
Entrez GeneID
54455GeneBank Accession#
NM_018994Protein Accession#
NP_061867Gene Name
FBXO42
Gene Alias
Fbx42, KIAA1332
Gene Description
F-box protein 42
Omim ID
609109Gene Ontology
HyperlinkGene Summary
Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM
Other Designations
OTTHUMP00000002236
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com