DEF6 monoclonal antibody (M01), clone 1F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DEF6 on formalin-fixed paraffin-embedded human lymph node [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of DEF6 transfected lysate using anti-DEF6 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DEF6 monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DEF6 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (62.7 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant DEF6.
Immunogen
DEF6 (AAH17504, 1 a.a. ~ 336 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (62.7 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DEF6 on formalin-fixed paraffin-embedded human lymph node [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of DEF6 transfected lysate using anti-DEF6 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DEF6 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DEF6 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — DEF6
Entrez GeneID
50619GeneBank Accession#
BC017504Protein Accession#
AAH17504Gene Name
DEF6
Gene Alias
IBP, SLAT
Gene Description
differentially expressed in FDCP 6 homolog (mouse)
Omim ID
610094Gene Ontology
HyperlinkGene Summary
DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 [PubMed 12923183]).[supplied by OMIM
Other Designations
IRF4-binding protein|OTTHUMP00000016251|differentially expressed in FDCP 6 homolog
-
Interactome
-
Disease
-
Publication Reference
-
DEF6 expression in ovarian carcinoma correlates with poor patient survival.
Liew PL, Fang CY, Lee YC, Lee YC, Chen CL, Chu JS.
Diagnostic Pathology 2016 Aug; 11(1):68.
Application：IHC-P, Human, Ovarian carcinoma.
-
Def-6, a Novel Regulator of Small GTPases in Podocytes, Acts Downstream of Atypical Protein Kinase C (aPKC) λ/ι.
Worthmann K, Leitges M, Teng B, Sestu M, Tossidou I, Samson T, Haller H, Huber TB, Schiffer M.
The American Journal of Pathology 2013 Dec; 183(6):1945.
Application：IF, WB-Ce, WB-Tr, Mouse, Kidney, Podocytes.
-
DEF6 expression in ovarian carcinoma correlates with poor patient survival.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com