STAU2 monoclonal antibody (M04), clone 1B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STAU2 monoclonal antibody (M04), clone 1B9 Western Blot analysis of STAU2 expression in IMR-32 ( Cat # L008V1 ).
Western Blot (Cell lysate)
STAU2 monoclonal antibody (M04), clone 1B9. Western Blot analysis of STAU2 expression in SW-13 ( Cat # L005V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAU2 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STAU2.
Immunogen
STAU2 (NP_055208, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STAU2 monoclonal antibody (M04), clone 1B9 Western Blot analysis of STAU2 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Cell lysate)
STAU2 monoclonal antibody (M04), clone 1B9. Western Blot analysis of STAU2 expression in SW-13 ( Cat # L005V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAU2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — STAU2
Entrez GeneID
27067GeneBank Accession#
NM_014393Protein Accession#
NP_055208Gene Name
STAU2
Gene Alias
39K2, 39K3, DKFZp781K0371, MGC119606
Gene Description
staufen, RNA binding protein, homolog 2 (Drosophila)
Omim ID
605920Gene Ontology
HyperlinkGene Summary
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
staufen homolog 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com