DAAM1 monoclonal antibody (M05), clone 5D3

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DAAM1.
Immunogen
DAAM1 (NP_055807, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DAAM1 monoclonal antibody (M05), clone 5D3 Western Blot analysis of DAAM1 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
DAAM1 monoclonal antibody (M05), clone 5D3. Western Blot analysis of DAAM1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody (M05), clone 5D3.
Lane 1: DAAM1 transfected lysate(122 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DAAM1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — DAAM1
Entrez GeneID
23002GeneBank Accession#
NM_014992Protein Accession#
NP_055807Gene Name
DAAM1
Gene Alias
FLJ41657, KIAA0666
Gene Description
dishevelled associated activator of morphogenesis 1
Omim ID
606626Gene Ontology
HyperlinkGene Summary
Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000179033|dishevelled-associated activator of morphogenesis 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Placental defects lead to embryonic lethality in mice lacking the Formin and PCP proteins Daam1 and Daam2.
Masa-Aki Nakaya, Kristibjorn Orri Gudmundsson, Yuko Komiya, Jonathan R Keller, Raymond Habas, Terry P Yamaguchi, Rieko Ajima.
PLoS One 2020 Apr; 15(4):e0232025.
Application:WB-Ce, Mouse, Mouse embryos, Mouse placentas.
-
Divergent roles of the Wnt/PCP Formin Daam1 in renal ciliogenesis.
Corkins ME, Krneta-Stankic V, Kloc M, McCrea PD, Gladden AB, Miller RK.
PLoS One 2019 Aug; 14(8):e0221698.
Application:IF, Mouse, IMCD3, MDCKII cells.
-
Molecular profile of endothelial invasion of three-dimensional collagen matrices: insights into angiogenic sprout induction in wound healing.
Su SC, Mendoza EA, Kwak HI, Bayless KJ.
American Journal of Physiology. Cell Physiology 2008 Sep; 295(5):C1215.
Application:WB-Ce, Human, HUVEC.
-
Daam1 regulates the endocytosis of EphB during the convergent extension of the zebrafish notochord.
Kida YS, Sato T, Miyasaka KY, Suto A, Ogura T.
PNAS 2007 Apr; 104(16):6708.
Application:IF, Human, HEK 293.
-
Placental defects lead to embryonic lethality in mice lacking the Formin and PCP proteins Daam1 and Daam2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com