STK38 monoclonal antibody (M03), clone 6F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STK38.
Immunogen
STK38 (AAH12085, 365 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STK38 monoclonal antibody (M03), clone 6F1. Western Blot analysis of STK38 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
STK38 monoclonal antibody (M03), clone 6F1 Western Blot analysis of STK38 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
STK38 monoclonal antibody (M03), clone 6F1. Western Blot analysis of STK38 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
STK38 monoclonal antibody (M03), clone 6F1. Western Blot analysis of STK38 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STK38 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — STK38
Entrez GeneID
11329GeneBank Accession#
BC012085Protein Accession#
AAH12085Gene Name
STK38
Gene Alias
NDR, NDR1
Gene Description
serine/threonine kinase 38
Omim ID
606964Gene Ontology
HyperlinkOther Designations
Ndr Ser/Thr kinase-like protein|OTTHUMP00000016293|nuclear Dbf2-related 1|serine threonine protein kinase
-
Interactome
-
Disease
-
Publication Reference
-
The Hippo network kinase STK38 contributes to protein homeostasis by inhibiting BAG3-mediated autophagy.
Klimek C, Jahnke R, Wördehoff J, Kathage B, Stadel D, Behrends C, Hergovich A, Höhfeld J.
Biochimica et Biophysica Acta. Molecular Cell Research 2019 Oct; 1866(10):1556.
Application:WB-Tr, Rat, A7r5 cells.
-
The Hippo network kinase STK38 contributes to protein homeostasis by inhibiting BAG3-mediated autophagy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com