STK38 monoclonal antibody (M04), clone 2F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STK38.
Immunogen
STK38 (AAH12085, 365 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STK38 monoclonal antibody (M04), clone 2F3. Western Blot analysis of STK38 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
STK38 monoclonal antibody (M04), clone 2F3. Western Blot analysis of STK38 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
STK38 monoclonal antibody (M04), clone 2F3 Western Blot analysis of STK38 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
STK38 monoclonal antibody (M04), clone 2F3. Western Blot analysis of STK38 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of STK38 expression in transfected 293T cell line by STK38 monoclonal antibody (M04), clone 2F3.
Lane 1: STK38 transfected lysate(54.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STK38 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of STK38 over-expressed 293 cell line, cotransfected with STK38 Validated Chimera RNAi ( Cat # H00011329-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with STK38 monoclonal antibody (M04) clone 2F3 (Cat # H00011329-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — STK38
Entrez GeneID
11329GeneBank Accession#
BC012085Protein Accession#
AAH12085Gene Name
STK38
Gene Alias
NDR, NDR1
Gene Description
serine/threonine kinase 38
Omim ID
606964Gene Ontology
HyperlinkOther Designations
Ndr Ser/Thr kinase-like protein|OTTHUMP00000016293|nuclear Dbf2-related 1|serine threonine protein kinase
-
Interactome
-
Disease
-
Publication Reference
-
Chromosome misalignments induce spindle-positioning defects.
Tame MA, Raaijmakers JA, Afanasyev P, Medema RH.
EMBO Reports 2016 Mar; 17(3):317.
Application:IF, Human, HeLa, U2OS cells.
-
Regulation of NDR1 activity by PLK1 ensures proper spindle orientation in mitosis.
Yan M, Chu L, Qin B, Wang Z, Liu X, Jin C, Zhang G, Gomez M, Hergovich A, Chen Z, He P, Gao X, Yao X.
Scientific Reports 2015 Jun; 5:10449.
Application:WB-Ce, Human, HeLa cells.
-
Chromosome misalignments induce spindle-positioning defects.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com