
SART3 MaxPab mouse polyclonal antibody (B01)

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human SART3 protein.
Immunogen
SART3 (AAH41638.1, 1 a.a. ~ 129 a.a) full-length human protein.
Sequence
MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEYAMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQVGPGVGSGHLPVFQVLGSPCPGPPP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (68)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Tissue lysate)
SART3 MaxPab polyclonal antibody. Western Blot analysis of SART3 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of SART3 expression in transfected 293T cell line (H00009733-T01) by SART3 MaxPab polyclonal antibody.
Lane 1: SART3 transfected lysate(14.19 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SART3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SART3
Entrez GeneID
9733GeneBank Accession#
BC041638.1Protein Accession#
AAH41638.1Gene Name
SART3
Gene Alias
DSAP1, KIAA0156, MGC138188, P100, RP11-13G14, TIP110, p110, p110(nrb)
Gene Description
squamous cell carcinoma antigen recognized by T cells 3
Omim ID
611684Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing. [provided by RefSeq
Other Designations
tat-interacting protein of 110 kDa
-
Interactomes
-
Publication Reference
-
Stress granule-associated protein G3BP2 regulates breast tumor initiation.
Gupta N, Badeaux M, Liu Y, Naxerova K, Sgroi D, Munn LL, Jain RK, Garkavtsev I.
PNAS 2017 Jan; 114(5):1033.
Application:Func, ICC, IF, IHC, WB, Human, BT474, MCF-7, MDA-MB-231, MDA-MB-453 cells, Human breast cancer.
-
Stress granule-associated protein G3BP2 regulates breast tumor initiation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com