PARN purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PARN MaxPab polyclonal antibody. Western Blot analysis of PARN expression in PC-12.
Western Blot (Cell lysate)
PARN MaxPab polyclonal antibody. Western Blot analysis of PARN expression in Hela S3 NE.
Western Blot (Cell lysate)
PARN MaxPab polyclonal antibody. Western Blot analysis of PARN expression in Raw 264.7.
Western Blot (Cell lysate)
PARN MaxPab polyclonal antibody. Western Blot analysis of PARN expression in NIH/3T3.
Western Blot (Transfected lysate)
Western Blot analysis of PARN expression in transfected 293T cell line (H00005073-T01) by PARN MaxPab polyclonal antibody.
Lane 1: PARN transfected lysate(70.29 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PARN on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PARN protein.
Immunogen
PARN (NP_002573.1, 1 a.a. ~ 639 a.a) full-length human protein.
Sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (87); Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PARN MaxPab polyclonal antibody. Western Blot analysis of PARN expression in PC-12.Western Blot (Cell lysate)
PARN MaxPab polyclonal antibody. Western Blot analysis of PARN expression in Hela S3 NE.Western Blot (Cell lysate)
PARN MaxPab polyclonal antibody. Western Blot analysis of PARN expression in Raw 264.7.Western Blot (Cell lysate)
PARN MaxPab polyclonal antibody. Western Blot analysis of PARN expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of PARN expression in transfected 293T cell line (H00005073-T01) by PARN MaxPab polyclonal antibody.
Lane 1: PARN transfected lysate(70.29 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PARN on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PARN
Entrez GeneID
5073GeneBank Accession#
NM_002582.1Protein Accession#
NP_002573.1Gene Name
PARN
Gene Alias
DAN
Gene Description
poly(A)-specific ribonuclease (deadenylation nuclease)
Omim ID
604212Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. This protein is also involved in silencing of certain maternal mRNAs during oocyte maturation and early embryonic development, as well as in nonsense-mediated decay (NMD) of mRNAs that contain premature stop codons. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
deadenylating nuclease
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com