CFL1 monoclonal antibody (M04), clone 1A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CFL1 monoclonal antibody (M04), clone 1A1 Western Blot analysis of CFL1 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
CFL1 monoclonal antibody (M04), clone 1A1. Western Blot analysis of CFL1 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
CFL1 monoclonal antibody (M04), clone 1A1. Western Blot analysis of CFL1 expression in Raw 264.7(Cat # L024V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CFL1 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CFL1 is approximately 10ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CFL1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (44 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CFL1.
Immunogen
CFL1 (AAH11005, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CFL1 monoclonal antibody (M04), clone 1A1 Western Blot analysis of CFL1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
CFL1 monoclonal antibody (M04), clone 1A1. Western Blot analysis of CFL1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
CFL1 monoclonal antibody (M04), clone 1A1. Western Blot analysis of CFL1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CFL1 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CFL1 is approximately 10ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CFL1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CFL1
Entrez GeneID
1072GeneBank Accession#
BC011005Protein Accession#
AAH11005Gene Name
CFL1
Gene Alias
CFL
Gene Description
cofilin 1 (non-muscle)
Omim ID
601442Gene Ontology
HyperlinkGene Summary
Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Determination of urine cofilin-1 level in acute kidney injury using a high-throughput localized surface plasmon-coupled fluorescence biosensor.
Chang YF, Chao CH, Lin LY, Tsai CH, Chou C, Lee YJ.
Journal of Biomedical Optics 2014 Jan; 19(1):11004.
Application：WB-Ce, Human, HK-2 cells.
-
Proteomic analysis of human Epithelial Lining Fluid by microfluidics-based nanoLC-MS/MS: a feasibility study.
Franciosi L, Govorukhina N, Fusetti F, Poolman B, Lodewijk ME, Timens W, Postma D, ten Hacken N, Bischoff R.
Electrophoresis 2013 Sep; 34(18):2683.
Application：IHC, Human, Lung.
-
Identification of phosphorylated serine-15 and -82 residues of HSPB1 in 5-fluorouracil- resistant colorectal cancer cells by proteomics.
Sakai A, Otani M, Miyamoto A, Yoshida H, Furuya E, Tanigawa N.
Journal of Proteomics 2012 Jan; 75(3):806.
Application：WB-Ce, Human, DLD-1 cells.
-
Overexpression of cofilin 1 can predict progression-free survival in patients with epithelial ovarian cancer receiving standard therapy.
Nishimura S, Tsuda H, Kataoka F, Arao T, Nomura H, Chiyoda T, Susumu N, Nishio K, Aoki D.
Human Pathology 2011 Apr; 42(4):516.
Application：IHC, Human, Ovarian tumor.
-
Determination of urine cofilin-1 level in acute kidney injury using a high-throughput localized surface plasmon-coupled fluorescence biosensor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com