CDK7 purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00001022-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship in 3 months
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

CDK7 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDK7 expression in human pancreas.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of CDK7 expression in transfected 293T cell line (H00001022-T01) by CDK7 MaxPab polyclonal antibody.

Lane 1: CDK7 transfected lysate(39.00 KDa).
Lane 2: Non-transfected lysate.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between CDK7 and E2F1. HeLa cells were stained with anti-CDK7 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between CDK7 and E2F1. Huh7 cells were stained with anti-CDK7 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against a full-length human CDK7 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    CDK7 (NP_001790.1, 1 a.a. ~ 346 a.a) full-length human protein.

    Sequence

    MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

    Host

    Rabbit

    Reactivity

    Human

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Tissue lysate)

    CDK7 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDK7 expression in human pancreas.

    Western Blot (Transfected lysate)

    Western Blot analysis of CDK7 expression in transfected 293T cell line (H00001022-T01) by CDK7 MaxPab polyclonal antibody.

    Lane 1: CDK7 transfected lysate(39.00 KDa).
    Lane 2: Non-transfected lysate.

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between CDK7 and E2F1. HeLa cells were stained with anti-CDK7 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between CDK7 and E2F1. Huh7 cells were stained with anti-CDK7 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — CDK7

    Entrez GeneID

    1022

    GeneBank Accession#

    NM_001799.2

    Protein Accession#

    NP_001790.1

    Gene Name

    CDK7

    Gene Alias

    CAK1, CDKN7, MO15, STK1, p39MO15

    Gene Description

    cyclin-dependent kinase 7

    Omim ID

    601955

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq

    Other Designations

    39 KDa protein kinase|Cdk-activating kinase|cell division protein kinase 7|cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase)|homolog of Xenopus MO15 Cdk-activating kinase|kinase subunit of CAK|serine/threonine kinase stk1|ser

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All