ARF5 monoclonal antibody (M01), clone 1B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ARF5.
Immunogen
ARF5 (AAH03043, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ARF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of ARF5 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
ARF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of ARF5 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
ARF5 monoclonal antibody (M01), clone 1B4 Western Blot analysis of ARF5 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
ARF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of ARF5 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ARF5 expression in transfected 293T cell line by ARF5 monoclonal antibody (M01), clone 1B4.
Lane 1: ARF5 transfected lysate(20.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARF5 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ARF5 on HeLa cell. [antibody concentration 15 ug/ml] -
Gene Info — ARF5
Entrez GeneID
381GeneBank Accession#
BC003043Protein Accession#
AAH03043Gene Name
ARF5
Gene Alias
-
Gene Description
ADP-ribosylation factor 5
Omim ID
103188Gene Ontology
HyperlinkGene Summary
ADP-ribosylation factor 5 (ARF5) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. The ARF5 gene spans approximately 3.2kb of genomic DNA and contains six exons and five introns. [provided by RefSeq
Other Designations
-
-
Interactome
-
Publication Reference
-
BIG1 Controls Macrophage Pro-Inflammatory Responses Through ARF3-mediated PI(4,5)P2 Synthesis.
Lixin Liu, Sulin Zhang, Yirui Wang, Weilian Bao, Yile Zhou, Wenzhen Dang, Xu Wang, Haidong Li, Xinyue Cao, Yan You, Hao Fang, Xiaoyan Shen.
Cell Death & Disease 2020 May; 11(5):374.
Application:WB-Ce, Mouse, Bone marrow-derived macrophages.
-
Cell survival and protein secretion associated with Golgi integrity in response to Golgi stress-inducing agents.
Ignashkova TI, Gendarme M, Peschk K, Eggenweiler HM, Lindemann RK, Reiling JH.
Traffic (Copenhagen, Denmark) 2017 Jun; 18(8):530.
Application:WB-Ce, Human, 786-0, A549, HeLa, MCF7, PANC1 cells.
-
Chlamydia Hijacks ARF GTPases To Coordinate Microtubule Posttranslational Modifications and Golgi Complex Positioning.
Wesolowski J, Weber MM, Nawrotek A, Dooley CA, Calderon M, St Croix CM, Hackstadt T, Cherfils J, Paumet F.
Mbio 2017 May; 8(3):e02280.
Application:WB, C. trachomatis, C. trachomatis transfected-, or infected-lysates.
-
Class I Arfs (Arf1 and Arf3) and Arf6 are localized to the Flemming body and play important roles in cytokinesis.
Hanai A, Ohgi M, Yagi C, Ueda T, Shin HW, Nakayama K.
Journal of Biochemistry 2016 Feb; 159(2):201.
Application:IF, WB-Tr, Human, HeLa cells.
-
A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens.
Reiling JH, Olive AJ, Sanyal S, Carette JE, Brummelkamp TR, Ploegh HL, Starnbach MN, Sabatini DM.
Nature Cell Biology 2013 Dec; 15(12):1473.
Application:WB, Human, PC3, HeLa cells.
-
ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus.
Nakai W, Kondo Y, Saitoh A, Naito T, Nakayama K, Shin HW.
Molecular Biology of the Cell 2013 Aug; 24(16):2570.
Application:IF, Human, HeLa cells.
-
Class II ADP-Ribosylation factors are required for efficient secretion of dengue viruses.
Kudelko M, Brault JB, Kwok K, Li MY, Pardigon N, Peiris JS, Bruzzone R, Despres P, Nal B, Wang PG.
The Journal of Biological Chemistry 2012 Jan; 287(1):767.
Application:WB-Tr, Human, HeLa cells.
-
GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis.
Takashima K, Saitoh A, Hirose S, Nakai W, Kondo Y, Takasu Y, Kakeya H, Shin HW, Nakayama K.
Cell Structure and Function 2011 Oct; 36(2):223.
Application:WB-Tr, Human, HeLa cells.
-
Interaction of phosphodiesterase 3A with brefeldin A-inhibited guanine nucleotide-exchange proteins BIG1 and BIG2 and effect on ARF1 activity.
Puxeddu E, Uhart M, Li CC, Ahmad F, Pacheco-Rodriguez G, Manganiello VC, Moss J, Vaughan M.
PNAS 2009 Apr; 106(15):6158.
Application:WB-Tr, Human, HepG2 cells.
-
EFA6 facilitates the assembly of the tight junction by coordinating an Arf6-dependent and independent pathway.
Klein S, Partisani M, Franco M, Luton F.
The Journal of Biological Chemistry 2008 Sep; 283(44):30129.
Application:WB, Dog, MDCK (NBL-2) cells.
-
The brefeldin A-inhibited guanine nucleotide-exchange protein, BIG2, regulates the constitutive release of TNFR1 exosome-like vesicles.
Islam A, Shen X, Hiroi T, Moss J, Vaughan M, Levine SJ.
The Journal of Biological Chemistry 2007 Feb; 282(13):9591.
Application:WB, Human, HUVEC.
-
BIG1 Controls Macrophage Pro-Inflammatory Responses Through ARF3-mediated PI(4,5)P2 Synthesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com