Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

PDGFA/PDGFB (Human) Recombinant Protein BioActive

  • Catalog # : P8129
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PDGFA/PDGFB (P01127|P04085) recombinant protein expressed in Escherichia coli .
  • Sequence:
  • PDGFA:MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT.
    PDGFB: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLGDHLACKCETVAAARPVT.
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 26.4
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • The ED50 as determined by the dose-dependent proliferation of mouse 3T3 indicator cells, is 1.4-2.1 ng/mL. This corresponds to a specific activity of 7.1x 105 units/mg.
  • Storage Buffer:
  • Lyophilized from 10mM AcOH
  • Storage Instruction:
  • Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20°C. Upon reconstitution should be stored at 4°C between 2-7 days and for future use below -20°C.
    Aliquot to avoid repeated freezing and thawing. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5154
  • Gene Name:
  • PDGFA
  • Gene Alias:
  • PDGF-A,PDGF1
  • Gene Description:
  • platelet-derived growth factor alpha polypeptide
  • Gene Summary:
  • The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer or as a heterodimer with the platelet-derived growth factor beta polypeptide, where the dimers are connected by disulfide bonds. Studies using knockout mice have shown cellular defects in oligodendrocytes, alveolar smooth muscle cells, and Leydig cells in the testis; knockout mice die either as embryos or shortly after birth. Two splice variants have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • PDGF A-chain,platelet-derived growth factor alpha,platelet-derived growth factor alpha chain,platelet-derived growth factor alpha isoform 2 preproprotein
  • Gene Information
  • Entrez GeneID:
  • 5155
  • Gene Name:
  • PDGFB
  • Gene Alias:
  • FLJ12858,PDGF2,SIS,SSV,c-sis
  • Gene Description:
  • platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
  • Gene Summary:
  • The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • PDGF, B chain,Platelet-derived growth factor, beta polypeptide (oncogene SIS),becaplermin,oncogene SIS,platelet-derived growth factor 2,platelet-derived growth factor beta,platelet-derived growth factor, B chain,v-sis platelet-derived growth factor beta p
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook