Product Browser

Last updated: 2022/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FLT3LG (Human) Recombinant Protein BioActiveGMP

  • Catalog # : P7009
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FLT3LG recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
  • Sequence:
  • MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 0.1 EU per 1 ug of the protein by the LAL method.
  • Activity:
  • Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED 50 for this effect is < 0.8 ng/mL. The specific activity of recombinant human Flt-3 Ligand is > 1.5x106 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P7009
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS, pH 8.0.
  • Storage Instruction:
  • Store at -20°C, lyophilized protein is stable for 1 year.
    After reconstitution with deionized water, store at -20 to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • Functional Study
  • Measure by its ability to induce proliferation in BaF3 cells. The ED50 for this effect is <0.8 ng/mL.
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2323
  • Gene Name:
  • FLT3LG
  • Gene Alias:
  • FL
  • Gene Description:
  • fms-related tyrosine kinase 3 ligand
  • Other Designations:
  • -
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook