Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

SLC25A25 MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00114789-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SLC25A25 protein.
  • Immunogen:
  • SLC25A25 (NP_443133.2, 1 a.a. ~ 469 a.a) full-length human protein.
  • Sequence:
  • MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQHYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMSSLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SLC25A25 expression in transfected 293T cell line (H00114789-T01) by SLC25A25 MaxPab polyclonal antibody.

    Lane1:SLC25A25 transfected lysate(51.59 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • SLC25A25
  • Gene Alias:
  • KIAA1896,MCSC,MGC105138,MGC119514,MGC119515,MGC119516,MGC119517,PCSCL,RP11-395P17.4,SCAMC-2
  • Gene Description:
  • solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
  • Other Designations:
  • OTTHUMP00000022250,mitochondrial ATP-Mg/Pi carrier,mitochondrial Ca2+-dependent solute carrier,short calcium-binding mitochondrial carrier 2,small calcium-binding mitochondrial carrier 2,solute carrier family 25, member 25,solute carrier family 25, member
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook