Product Browser

Last updated: 2023/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IRX6 monoclonal antibody (M01), clone 1A5 

  • Catalog # : H00079190-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant IRX6.
  • Immunogen:
  • IRX6 (NP_077311, 337 a.a. ~ 446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PRLTMHYPCLEKPRIWSLAHTATASAVEGAPPARPRPRSPECRMIPGQPPASARRLSVPRDSACDESSCIPKAFGNPKFALQGLPLNCAPCPRRSEPVVQCQYPSGAEAG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00079190-M01
    Western Blot detection against Immunogen (37.84 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (75); Rat (76)
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of IRX6 expression in transfected 293T cell line by IRX6 monoclonal antibody (M01), clone 1A5.

    Lane 1: IRX6 transfected lysate(48.169 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged IRX6 is 0.1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of IRX6 over-expressed 293 cell line, cotransfected with IRX6 Validated Chimera RNAi ( Cat # H00079190-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with IRX6 monoclonal antibody (M01), clone 1A5 (Cat # H00079190-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Gene Name:
  • IRX6
  • Gene Alias:
  • IRX-3,IRX7,IRXB3
  • Gene Description:
  • iroquois homeobox 6
  • Other Designations:
  • iroquois homeobox protein 1-like,iroquois homeobox protein 6,iroquois homeobox protein 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook